PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36166.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 701aa    MW: 76113.6 Da    PI: 7.4103
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36166.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094675041954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  KHN36166.1 467 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 504
                 664559******************************88 PP

2BELL91.39.4e-303433971872
        BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +Vd+rY++y+eq+q+v++sF+ ++g g+a pYt+lA+ka+SrhFrcLk+ai+ q+
  KHN36166.1 343 KVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSRHFRCLKEAITAQL 397
                 7***************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-64266395IPR006563POX domain
PfamPF075263.9E-40271394IPR006563POX domain
PROSITE profilePS5007112.568445508IPR001356Homeobox domain
SMARTSM003891.2E-9448512IPR001356Homeobox domain
CDDcd000863.90E-12448509No hitNo description
SuperFamilySSF466893.34E-17449515IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-29451514IPR009057Homeodomain-like
PfamPF059203.5E-18465504IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MSQDFQQGIF SFPNGLERGR VMSPQQQIRR DKVRFEAAPL VGIEEEEPVY ETAGMLSEMF  60
NFPPATELLE QQHATATFRA ARQAGEWYGN RQQQQQQISG INADSAAAMQ LFLMNPQTRS  120
PSPPQSHTTP SSTLHMLLPN PSSNSLQGFT GSAAGGSFGQ FTWVPEGAHQ QGGVVEGQGL  180
SLSLSSSLEA AKAEELRMGD SGFLYYNHQQ GGGGGGGGGG PSSSSSAVQF QYKNNNSHHH  240
QALHLQGAMG HDNNHQGHVG FGSSSLGVVN VLRNSKYVKA AQELLEEFCS VGRGQFKKSK  300
FNRQNSNPNS NPGGGGSSPS SKDAPPPPPP LSAADRIEHQ RRKVDRRYNH YCEQMQMVVN  360
SFDLMMGFGA AVPYTALAQK AMSRHFRCLK EAITAQLKQS CEVLGDKDGA GSSGGLTKGE  420
TPRLKMLEQS LRQQRAFHQM GMMEQEAWRP QRGLPERSVN ILRAWLFEHF LHPYPSDADK  480
HLLARQTGLS RNQVSNWFIN ARVRLWKPMV EEMYQQELKE AESAEEREKD QSNNISGNQA  540
QIPTTPSAAT TSTATATAPP PPPSTTTKTT KPTGKRSDTI NAPESDPSQH LAMNNRQGFS  600
ENQAKKSTAS TTTTTIASEV APPVSQCFDD SDLPAHRLMA SDDTCHLVTA DFGTASASAD  660
IGSTLIRFGT TPGDVSLTLG LRHAGNMPEK SPFSVRDFGA I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16454512563Homeobox protein Meis2
3k2a_B1e-16454512563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014631522.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_014631523.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-176BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0B2RNT30.0A0A0B2RNT3_GLYSO; BEL1-like homeodomain protein 2
STRINGGLYMA01G38650.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-133BEL1-like homeodomain 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]